PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr2g090305.1
Common NameMTR_2g090305
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 190aa    MW: 21439.9 Da    PI: 9.4026
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr2g090305.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.62.5e-122973347
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +WT+eE++l+  + ++  +g+W+ I+r   k+Rt+ q+ s+ qky
  Medtr2g090305.1 29 PWTEEEHKLFSVGLQKVDKGDWRGISRNYVKTRTPSQVASHAQKY 73
                     7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007178.0E-62676IPR001005SANT/Myb domain
SuperFamilySSF466892.34E-142877IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-142875IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.8E-82972IPR009057Homeodomain-like
PfamPF002492.2E-92973IPR001005SANT/Myb domain
PROSITE profilePS500906.2722974IPR017877Myb-like domain
CDDcd001671.19E-82974No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MFGAEFLRAV FCVPPVLCVF CEFASGLIPW TEEEHKLFSV GLQKVDKGDW RGISRNYVKT  60
RTPSQVASHA QKYFLCRSNR NCCRHRSSLF DITTDRGYFL LAIVRNVNVK TNLFHLKMDS  120
SLKPVATLDD YLANVVPLFG GFLSILGVSE LATWVIDARY GVKLSPLFLV PSNALYFSDT  180
YFYSKKNGK*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.43501e-82flower| glandular trichome| leaf| pod| root| seed| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1388997e-80BT138899.1 Medicago truncatula clone JCVI-FLMt-13C5 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013465085.11e-139myb-like DNA-binding domain, shaqkyf class protein
TrEMBLA0A072VLS71e-139A0A072VLS7_MEDTR; Myb-like DNA-binding domain, shaqkyf class protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.22e-27MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]